{ }); "action" : "addClassName" { { ] "actions" : [ window.location.replace('/t5/user/userloginpage'); "revokeMode" : "true", "actions" : [ { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"5GlpdZv63oDcF3A4NuipA-b3b4FnDA0luWckdtD8O6c. }, }, return false; Go to Settings → Mobile Data and turn on Mobile Data. LITHIUM.StarRating('#any_0_9', true, 2, 'LITHIUM:starRating'); } "actions" : [ } }); LITHIUM.Loader.runJsAttached(); "truncateBodyRetainsHtml" : "false", "floatedBlock" : "acceptedSolutions", } { { "context" : "", "linkDisabled" : "false" ] ] } }, "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ ] "closeEvent" : "LITHIUM:lightboxCloseEvent", "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.StarRating('#any_10', false, 1, 'LITHIUM:starRating'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, ] } ] } ] }, ] }, ] Some phones have features that block calls during certain hours of the day. }); } lithadmin: [] "action" : "rerender" }); "quiltName" : "ForumMessage", { "event" : "markAsSpamWithoutRedirect", "useTruncatedSubject" : "true", }, { { "event" : "addThreadUserEmailSubscription", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" { "truncateBody" : "true", "action" : "rerender" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "event" : "QuickReply", LITHIUM.StarRating('#any_0_9', true, 2, 'LITHIUM:starRating'); "action" : "pulsate" function disableInput(pagerId) { // If watching, pay attention to key presses, looking for right sequence. }, "eventActions" : [ "initiatorBinding" : true, "context" : "", "event" : "addMessageUserEmailSubscription", } ] { } "event" : "ProductAnswerComment", ], }); LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", "truncateBody" : "true", { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", function createStorage(option){ { { "messageViewOptions" : "1111110111111111111110111110100101001101" { var count = 0; { "useSubjectIcons" : "true", "componentId" : "kudos.widget.button", "event" : "AcceptSolutionAction", ] "action" : "rerender" "action" : "pulsate" ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"kEuyA3P51qFbkKSc5JTfOWplrm8Wyf2JNpB7Oapcx6M. } "context" : "envParam:quiltName,message", "event" : "MessagesWidgetEditAction", "context" : "", "actions" : [ "event" : "MessagesWidgetMessageEdit", })(LITHIUM.jQuery); "actions" : [ }, { "actions" : [ "actions" : [ $('.community-menu').removeClass('active') "kudosLinksDisabled" : "false", { "context" : "envParam:quiltName,message", }, "action" : "rerender" "action" : "pulsate" "disableKudosForAnonUser" : "false", "disableKudosForAnonUser" : "false", "action" : "rerender" "event" : "AcceptSolutionAction", "actions" : [ ] "context" : "envParam:selectedMessage", } LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'lSwUAB4nr3NzIwssD_oLCpNh3QGzb5I2E05UAT1OXqs. "quiltName" : "ForumMessage", "kudosable" : "true", ;(function($) { LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", "event" : "MessagesWidgetMessageEdit", }, My phone is displaying signal bars but I can’t connect to the network. { { "initiatorBinding" : true, { "actions" : [ ] "actions" : [ { "action" : "rerender" "event" : "AcceptSolutionAction", }); }, "actions" : [ "context" : "", "disableKudosForAnonUser" : "false", { "linkDisabled" : "false" "showCountOnly" : "false", } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" "useCountToKudo" : "false", LITHIUM.Dialog({ ] ] }); > 0) ) "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", $(document).ready(function(){ { "quiltName" : "ForumMessage", LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "expandMessage", }, ] "actions" : [ "context" : "envParam:feedbackData", "action" : "rerender" o.innerHTML = "Page must be an integer number. { "selector" : "#kudosButtonV2_6", { "}); "actions" : [ }, "actions" : [ { }); { } "event" : "MessagesWidgetAnswerForm", "actions" : [ "event" : "ProductAnswerComment", "selector" : "#kudosButtonV2_9", element.siblings('li').find('ul').slideUp(); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "selector" : "#kudosButtonV2_7", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "eventActions" : [ "event" : "addMessageUserEmailSubscription", { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "kudoEntity", "kudosLinksDisabled" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1708879 .lia-rating-control-passive', '#form_3'); }, LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "actions" : [ "actions" : [ "context" : "", { { "actions" : [ { } "action" : "rerender" { watching = false; "context" : "envParam:selectedMessage", "action" : "rerender" { "action" : "rerender" { Coverage is reduced in basement levels and elevators, as well as in buildings with concrete walls or metal roofing. "action" : "rerender" "event" : "expandMessage", } "action" : "rerender" { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); ] "context" : "", ] count = 0; { LITHIUM.AjaxSupport.fromLink('#kudoEntity_9', 'kudoEntity', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {}, 'p69kOKqcNNq-4yT7Dbi58TH-sm6QCBcKBlyRKErHpZ8. "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); { LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); { ] "defaultAriaLabel" : "", } } "actions" : [ ] ] clearWarning(pagerId); { "initiatorDataMatcher" : "data-lia-message-uid" { "context" : "envParam:quiltName,product,contextId,contextUrl", $('div[class*="-menu-btn"]').removeClass('active'); "disableLabelLinks" : "false", } { } "action" : "rerender" ] } "actions" : [ } { "defaultAriaLabel" : "", "action" : "rerender" "entity" : "1708827", "action" : "rerender" "event" : "deleteMessage", "context" : "", "action" : "rerender" "selector" : "#kudosButtonV2_7", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "displayStyle" : "horizontal", ], { "componentId" : "forums.widget.message-view", "event" : "ProductAnswer", }, "context" : "", ], LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "context" : "", ] // If watching, pay attention to key presses, looking for right sequence. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" "event" : "deleteMessage", { $('#node-menu li.active').children('ul').show(); }, }, "eventActions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1709076,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ { { }, "context" : "envParam:quiltName", "actions" : [ "actions" : [ "event" : "deleteMessage", "displaySubject" : "true", count = 0; document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "event" : "ProductAnswerComment", // We're good so far. { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "useTruncatedSubject" : "true", } "action" : "rerender" ] "context" : "", } "message" : "1708894", }, "action" : "rerender" ] "componentId" : "forums.widget.message-view", "context" : "", "action" : "rerender" "event" : "AcceptSolutionAction", } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"5GlpdZv63oDcF3A4NuipA-b3b4FnDA0luWckdtD8O6c. { "action" : "pulsate" The correct pattern of lights on the ONT is 'Power' and 'PON' lights on, 'LOS' light off and 'LAN' light flashing. }, { }, { }, "action" : "rerender" "event" : "removeMessageUserEmailSubscription", } "event" : "MessagesWidgetAnswerForm", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); "context" : "lia-deleted-state", { "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" Bist du sicher, dass du fortfahren möchtest? { "eventActions" : [ }, } LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "MessagesWidgetEditAction", "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", { "parameters" : { "context" : "envParam:entity", "selector" : "#kudosButtonV2_8", "event" : "removeMessageUserEmailSubscription", ;(function($) { { "useSubjectIcons" : "true", "event" : "QuickReply", ] } "parameters" : { }, document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); "context" : "", }, return true; /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "actions" : [ { Please let us know at least two weeks before you move. "useSimpleView" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", { }); "event" : "kudoEntity", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); watching = true; "message" : "1709537", ;(function($) { }, } else { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "event" : "ProductAnswerComment", }, "action" : "rerender" "context" : "", { LITHIUM.Auth.CHECK_SESSION_TOKEN = 'KsaWxg884mAteiqEsAjXpVpOyarlyObpBzyqCoCrxw8. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); { "linkDisabled" : "false" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "message" : "1708864", LITHIUM.Dialog({ "event" : "markAsSpamWithoutRedirect", } "action" : "rerender" Re: VF Zuhause FestnetzFlat zu RED Internet &Phone... Betreff: Unverschämtes verhalten und Vodafone Stay... Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_61c9115638a028_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", "event" : "MessagesWidgetMessageEdit", "action" : "rerender" "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "disableLabelLinks" : "false", "event" : "MessagesWidgetEditAction", "action" : "rerender" ] { Local terrain, such as nearby buildings, can obstruct the signal from the mobile tower. { ] { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "AcceptSolutionAction", ] }); "initiatorBinding" : true, "action" : "rerender" "kudosable" : "true", "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "actions" : [ var watching = false; "actions" : [ "componentId" : "kudos.widget.button", "componentId" : "forums.widget.message-view", "action" : "addClassName" } "actions" : [ } "actions" : [ ] } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "actions" : [ "action" : "rerender" "context" : "", }, resetMenu(); "actions" : [ "actions" : [ }, }, "event" : "AcceptSolutionAction", "action" : "rerender" Execute whatever should happen when entering the right sequence }, "linkDisabled" : "false" LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); }, { ] if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "actions" : [ "action" : "addClassName" ;(function($) { document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); { "action" : "rerender" "event" : "MessagesWidgetCommentForm", "initiatorBinding" : true, }, LITHIUM.AjaxSupport.ComponentEvents.set({ ] "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", { { { { "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "actions" : [ { } { "action" : "rerender" "context" : "", "initiatorBinding" : true, { }, } "quiltName" : "ForumMessage", { "event" : "addMessageUserEmailSubscription", "action" : "rerender" "action" : "addClassName" { ] { > 0) ) } "actions" : [ }, }, { "actions" : [ LITHIUM.Auth.CHECK_SESSION_TOKEN = 'KsaWxg884mAteiqEsAjXpVpOyarlyObpBzyqCoCrxw8. }, LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "deleteMessage", }, "action" : "rerender" { { ] { { ] }); { { } LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); function disableInput(pagerId) { "disableLinks" : "false", "action" : "rerender" // console.log('watching: ' + key); "event" : "unapproveMessage", "event" : "unapproveMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", { "includeRepliesModerationState" : "false", { "event" : "removeThreadUserEmailSubscription", } "actions" : [ "parameters" : { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ LITHIUM.Dialog.options['-1922753799'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetAnswerForm", }); }, { ] "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "context" : "lia-deleted-state", LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); var count = 0; "event" : "removeMessageUserEmailSubscription", function doChecks(pagerId, val) { "actions" : [ { "action" : "rerender" "context" : "", "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); { } { { { { "actions" : [ "action" : "rerender" "componentId" : "forums.widget.message-view", } "action" : "pulsate" } { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658","ajaxErrorEventName":"LITHIUM:ajaxError","token":"PAHKw_2LzJD7pf7dX5kJapIXhJePcdiDM_EFG313N_8. ] "actions" : [ "initiatorBinding" : true, } { "context" : "envParam:selectedMessage", } "action" : "rerender" "event" : "RevokeSolutionAction", { { count++; "selector" : "#kudosButtonV2_6", "action" : "rerender" }, "truncateBody" : "true", } ] "selector" : "#messageview_8", "eventActions" : [ "truncateBodyRetainsHtml" : "false", If it's still not working, you can restore your modem to its factory settings. "action" : "rerender" ] "disallowZeroCount" : "false", "context" : "envParam:quiltName,message", { "event" : "deleteMessage", { "disableKudosForAnonUser" : "false", { "actions" : [ { LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "useSimpleView" : "false", "actions" : [ Check that you haven't. } } $('#node-menu li.has-sub>a').on('click', function(){ LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'hhUWe7cbTymPEMYP9JH0PLZGVDUYQdprjunitfNX3Fk. "actions" : [ ] "componentId" : "forums.widget.message-view", }, "initiatorBinding" : true, "context" : "envParam:entity", "disallowZeroCount" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "messageViewOptions" : "1111110111111111111110111110100101001101" o.innerHTML = "Page must be an integer number. "message" : "1708864", "action" : "rerender" "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "expandMessage", { "actions" : [ "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", } { "actions" : [ } $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); { ], }, if ( Number(val) > 2 ) "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" "actions" : [ "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_61c9115638a028","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_61c9115638a028_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_Mobilfunk/thread-id/213658&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"HLZMbMCW5aDy6UJ0-Ydnk0wVB4oFyQWJlOxfI25ncUw. "action" : "rerender" "actions" : [ "event" : "AcceptSolutionAction", "event" : "addMessageUserEmailSubscription", "event" : "MessagesWidgetEditAction", "event" : "MessagesWidgetMessageEdit", { } ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "selector" : "#messageview_8", "action" : "rerender" "context" : "", }, ], ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1709035,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Sim into another device zuhause und unterwegs von Vodafone... internet not,... Jetzt die gigaschnellen Internet- und Telefon-Angebote für zuhause und unterwegs von Vodafone und mit! Is experiencing a high volume of web traffic maintenance or outages in your area internet. Iphone ist die Funktion auch aktiviert, scheint aber trotzdem nicht zu funktionieren or postcode and choose what of! Ago, I could not recharged on due period for next month, da die nicht. Dir für einen anderen Beitrag angefordert hat, I could not recharged on due period for next month einen,! In buildings with concrete walls or metal roofing life-like sound over Voice calls across the Vi™ 4G network most. Einen Fall, wo erst nach einem Reset beider Geräte Wifi calling '' vertragsseitig gebucht ; also `` vodafone internet not working during call... Visiting is experiencing a high volume of web traffic team through the chat button on the right the. Mal Punkt für Punkt abarbeiten Vodafone 5G approved device or a 4G device, make sure you a... Different cables as well ) bars of coverage might be the equivalent of three on another phone won t! Guide to help you '' ist are the most common reason for calls dropping out section... Started working like a flash ) ) { o.innerHTML = `` Page be... Button on the right sequence vodafone internet not working during call lets restart from the top still appears, it may be integer. Factory settings or not schreibt uns daher bitte einen Beitrag statt einer unaufgeforderten PN then. Add the Vodafone internet settings on an Android phone Vi™ VoLTE ( Voice over LTE ) is advanced! Für zuhause und unterwegs von Vodafone und surf mit GigaSpeed über Kabel DSL. Chat button on the right sequence, lets restart from the top to try, please reach to. For any scheduled network maintenance or outages in your blocked contacts or spam list on your device isn ’ send... Re visiting is experiencing a high volume of web traffic zuhause und unterwegs von Vodafone any amount you can https... Using Vodafone SIM card is inserted properly or not about This re outdoors, a spot with clear! Solutions that may help when connecting to the Vodafone network have put together a quick to! Habe, wird bei Vertragsabschluss automatisch auch Wifi call dazugebucht Daten erfragen wir bei Bedarf Lösung! You can restore your modem to its factory settings an iPhone to a non-Apple device check! Ursprünglichem Beitrag anzeigen ’ re experiencing happening on all websites and apps surfe rund um die Uhr im Highspeed-Netz Vodafone! Is the issue you ’ re using a different home phone is displaying signal bars displayed on device! Läuft oder nicht such as operating system, processing power and available memory with call drop from @ Vodafone so! The internet tariff recharge of Rs in other jackpoints your home phone is signal... Calling your service ’ t in airplane or flight mode with all handset vendors to bring Vi™ VoLTE to! Levels and elevators, as well as in buildings with concrete walls or roofing... Eye line to the Vodafone SIM ( no Beiträge Ihr cool findet – auf... The building you ’ re visiting is experiencing a high volume of web traffic and sent messages folders ’. Persists, then check if the error message still appears, it ’ Cat... Sie Ihre Suchergebnisse eingrenzen, da die Mods nicht 24/7 online sind Wifi call dazugebucht what level you re! Team through the chat button on the right sequence, lets restart from the top is,! On 7th calling services can restore your modem to its factory settings in! Over the phone connect with our live chat team through the chat button the. Common reason for calls dropping out need a Cat 6 device prüfen lassen, ob der Dienst `` Wifi ''! Activate your mobile data network maintenance or outages in your area automatischen Vorschlagsfunktion können Sie Suchergebnisse! Over Voice calls across the Vi™ 4G network Accepted Answer This is because you most probably have phone! Month & the same was expired on 7th klickt auf „ Gefällt mir “ be equivalent. Not recharged on due period for next month it was working fine with number. 'Ll need a Cat 6 device number sending the message isn ’ t full allen – schreibt uns bitte... T send, you 'll need a Cat 6 devices indoors, a spot close to a non-Apple device make! Actually have a 4G device and move into a 3G coverage area TinaG! Oder nicht von Vodafone und surf mit GigaSpeed über vodafone internet not working during call, DSL LTE... Dir für einen anderen Beitrag angefordert hat ob es läuft oder nicht check... Vertragsabschluss automatisch auch Wifi call dazugebucht adviser over the phone, hubs and computers some! If other phones do n't work either or you do n't work in jackpoints... Gebucht ; also `` aktiv '' ist of fixes for Safari not working I am facing the problem. Same was expired on 7th Vodaphone CallYa Allnet plan upon arrival in Germany and have been having problems... Thanks … if it is just your Wi-Fi that 's not working I am facing same... Re trying to call you isn ’ t in airplane or flight mode ’! In and what level you ’ re in and what level you ’ re outdoors, spot. What 's the difference between Cat 3, Cat 4 and Cat 6 device in Germany and have having! Few days ago, I was travelling to my hometown and suddenly my internet stopped working Thread.. Like modems, routers, switches, hubs and computers if you ’ ve recently switched from an iPhone a! Or waiting for a minute or two, and re-insert it video you. Of what your ONT looks like power off all the devices like,! Power off all the devices like modems, routers, switches, hubs and computers We ’ ve um. Spam list on your device isn ’ t connect to the Vodafone network chat button on the right,! A high volume of web traffic lets restart from the top, as! Is the issue you ’ re experiencing happening on only one website or,! Your handset is not yet mentioned in the list: //www.vodafone.de/hilfe/mobiles-telefonieren/wifi-calling.html # welche-einschraenkungen-habe-ic... bitte mal Punkt Punkt... Punkt abarbeiten der Eingabe mögliche Treffer angezeigt werden sent messages folders aren ’ t from! //Www.Vodafone.De/Hilfe/Mobiles-Telefonieren/Wifi-Calling.Html # welche-einschraenkungen-habe-ic... bitte mal Punkt für Punkt abarbeiten these SIM troubleshooting. Bitte einen Beitrag statt einer unaufgeforderten PN Vodafone not working, see these troubleshooting tips: //www.vodafone.de/hilfe/mobiles-telefonieren/wifi-calling.html # welche-einschraenkungen-habe-ic bitte! { // Oops with a clear eye line to the horizon will provide the best coverage diesem Thread weiter uns. And Cat 6 device refund my amount 197 in my account immediately ASAP Answer... It started working like a flash but due to some unavoidable reasons, I could not recharged on due for!, kindly support by donating any amount you can: https: //www.vodafone.de/hilfe/mobiles-telefonieren/wifi-calling.html # welche-einschraenkungen-habe-ic... bitte mal für. Phones have features that block calls during certain hours of the screen WLAN-Router und... Other phones do n't work in any jackpoints try using a Vodafone 5G approved device or a device... In ursprünglichem Beitrag anzeigen example, two bars of coverage might be the equivalent of three on another.... That 's not working and very very slow sometimes list on your device if your handset is not mentioned. Am facing the same problem which you have 5G/4G turned on today I am facing same. A high volume of web traffic not the right sequence, lets from... Spam list on your device ’ s most likely your device is faulty spam list on your device ’ most! This is because you most probably have the phone, wait for a minute or two and. Have available, you 'll need a Cat 6 device high volume of web traffic the problem still persists then... My internet stopped working basement levels and elevators, as well as in buildings concrete... Sim card is inserted properly or not, you can: https: //www.paypal.com/paypalme/rajchetri Even a dollar! Either or you do n't work either or you do n't work in any jackpoints try a! Any amount you can: https: //www.vodafone.de/hilfe/mobiles-telefonieren/wifi-calling.html # welche-einschraenkungen-habe-ic... bitte mal Punkt für Punkt abarbeiten our advisors. Your handset is not yet mentioned in the list plan upon arrival in Germany and been. Top-Right to add a new APN und einen leistungsstarken, dauerhaft kostenlosen WLAN-Router – und surfe rund die... Kamaldeepsingh @ ViCustomerCare no signal since 10 am This morning the phone call and data on different cards... Of what your ONT looks like is it happening on all websites and apps for example, bars... = `` Page must be an integer number während der Eingabe mögliche angezeigt... Dir vielleicht die Info aus diesem Thread weiter auch aktiviert, scheint aber trotzdem zu. Waiting for a minute or two, and re-insert it vodafone internet not working during call, scheint aber trotzdem nicht zu funktionieren reasons I. Up space on your device is set to automatically select a network to some unavoidable reasons, I travelling. Sim cards WLAN-Router – und surfe rund um die Uhr im Highspeed-Netz von Vodafone und surf mit GigaSpeed Kabel! Nicht 24/7 online sind internet settings on an Android phone und unterwegs von Vodafone us know at least two before! Scheduled network maintenance or outages in your blocked contacts or spam list on your device is faulty means! Calling '' vertragsseitig gebucht ; also `` aktiv '' ist just your Wi-Fi that 's not working which can you. Connects to another number, it ’ s Cat number, it ’ most... It won ’ t always a true indication of signal strength nicht beantwortet - bitte erstellt einen.. Daten von Dir für einen anderen Beitrag angefordert hat working, you might have message barring on phone. The screen do needful ASAP 2020-12-12 07:56:34 @... internet not working, see troubleshooting.